ࡱ> .0-5@ bjbj22 "XX 6666666Jnnnn z J#2$UR 666FFF~66FFF^66^ W_n"^0#^ 2 ^JJ6666 6^DFJJ$n< JJnLOCUS DQ458305 637 bp mRNA linear INV 05-APR-2006 DEFINITION Mayetiola destructor clone Pg5F6 small secreted gut protein mRNA, complete cds. ACCESSION DQ458305 VERSION DQ458305 KEYWORDS . SOURCE Mayetiola destructor (Hessian fly) ORGANISM Mayetiola destructor Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea; Cecidomyiidae; Mayetiola. REFERENCE 1 (bases 1 to 637) AUTHORS Chen,M.-S., Liu,X., Zhu,Y.-C., Reese,J.C. and Wilde,G.E. TITLE Genes Encoding a Group of Related Small Secreted Proteins from the Gut of Hessian Fly Larvae [Mayetiola destructor (Say)] JOURNAL Insect Sci. (2006) In press REFERENCE 2 (bases 1 to 637) AUTHORS Chen,M.-S. TITLE Direct Submission JOURNAL Submitted (17-MAR-2006) USDA-ARS and Department of Entomology, Kansas State University, 123 Waters Hall, Manhattan, KS 66506, USA FEATURES Location/Qualifiers source 1..637 /organism="Mayetiola destructor" /mol_type="mRNA" /db_xref="taxon:39758" /clone="Gg5F6" CDS 33..494 /codon_start=1 /product="small secreted gut protein" /protein_id="ABE26923" /translation="MKLSLFIVIGALFCATVKSSERSSLIRELMKKNGSDFVQAFQCM VDVVGTVSNANGFSELWSQSEPVAKYHLEKWLMCPQAGDKLAVVLCNIREGLLTIQVL NEYFQLVFAQNPKASKLIAVEYYKRCASFELVDDFLPEILNEKEIIVNDMI" ORIGIN 1 cattcgtttt gtatttcagt aacgacatca aaatgaaatt atcattgttc attgttattg 61 gtgcactttt ttgtgccacg gtgaaatcaa gtgaacgatc atcattaatt cgggaattaa 121 tgaaaaaaaa tggttcagat tttgttcagg cattccaatg tatggtcgat gtcgttggta 181 cggtctcaaa tgcgaatggt ttttctgaac tatggtctca atcagagccc gttgccaaat 241 atcatttgga aaaatggcta atgtgtcctc aggcaggcga taaattggct gttgttttgt 301 gtaacattcg agagggactg ctaactatac aagttctaaa cgaatatttt caattggttt 361 ttgctcaaaa cccaaaagcg tccaaactca tcgctgttga atattataaa cgttgcgcat 421 catttgaatt agttgatgac tttttgccag aaatcttgaa cgaaaaagag atcatcgtca 481 atgatatgat ctgatagaaa aaataaaacg aacacagaaa ttattgctgc tttagaattg 541 gcaaaattat tattattcac aaattaatat gaatatattt ttgttttgat cgctgaaatt 601 aaatttggat tgggaataaa gaaattgaag cagcgtt  hMI^hhCJOJQJ^JaJ#hMI^B*CJOJQJ^JaJph)hMI^hMI^B*CJOJQJ^JaJphgdMI^ 1h/ =!"#$%D@D NormalCJ_HaJmH nHsH tHDA@D Default Paragraph FontRi@R  Table Normal4 l4a (k@(No List  0   )+\e+4LUW^`jltv}"(.36;AJPYAGir(3   !+6@AKLVWablmw$%/0:;EFPQ[fpq{|     ) * 4 5 ? J T U _ ` j k u v Pe 33  m. Chen  (E?20BMI^ht#=llyF0z@ٞ @UnknownGz Times New Roman5Symbol3& z Arial?5 z Courier New;SimSun[SO"qhsstKtK24 3QH)?hOLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006m. Chenm. ChenOh+'0 $4 DP l xPLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006OCUm. Chen. C. CNormalm. Chen2 CMicrosoft Word 10.0@@p_@p_tK՜.+,0< hp  USDA  A PLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006 Title  !"#$&'()*+,/Root Entry FLf_1Data 1TableWordDocument"SummaryInformation(DocumentSummaryInformation8%CompObjj  FMicrosoft Word Document MSWordDocWord.Document.89q