╨╧рб▒с>■  .0■   -                                                                                                                                                                                                                                                                                                                                                                                                                                                ье┴5@ Ё┐═bjbj╧2╧2 "нXнX═       И6666666Jnnnn z JK2ТТТТТТТТ╩╠╠╠╠╠╠$}R╧ фЁ6ТТТТТЁ66ТТRRRТК6Т6Т╩RТ╩RRj66jТЖ X║¤_╞n"j╩0Kj│ > │ jJJ6666│ 6j`ТТRТТТТТЁЁJJ$nH JJnLOCUS а а а DQ458311 а а а а а а а а 650 bp а аmRNA а аlinear а INV 05-APR-2006 DEFINITION аMayetiola destructor clone Gg7G4 small secreted gut protein mRNA, аа а а а а аcomplete cds. ACCESSION а DQ458311 VERSION а а DQ458311 KEYWORDS а а. SOURCE а а аMayetiola destructor (Hessian fly) ааORGANISM аMayetiola destructor аа а а а а аEukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; аа а а а а аNeoptera; Endopterygota; Diptera; Nematocera; Sciaroidea; аа а а а а аCecidomyiidae; Mayetiola. REFERENCE а 1 а(bases 1 to 650) ааAUTHORS а Chen,M.-S., Liu,X., Zhu,Y.-C., Reese,J.C. and Wilde,G.E. ааTITLE а а Genes Encoding a Group of Related Small Secreted Proteins from the аа а а а а аGut of Hessian Fly Larvae [Mayetiola destructor (Say)] ааJOURNAL а Insect Sci. (2006) In press REFERENCE а 2 а(bases 1 to 650) ааAUTHORS а Chen,M.-S. ааTITLE а а Direct Submission ааJOURNAL а Submitted (17-MAR-2006) USDA-ARS and Department of Entomology, аа а а а а аKansas State University, 123 Waters Hall, Manhattan, KS 66506, USA FEATURES а а а а а а Location/Qualifiers аа а source а а а а а1..650 аа а а а а а а а а а /organism="Mayetiola destructor" аа а а а а а а а а а /mol_type="mRNA" аа а а а а а а а а а /db_xref="taxon:39758" аа а а а а а а а а а /clone="Gg7G4" аа а CDS а а а а а а 33..494 аа а а а а а а а а а /codon_start=1 аа а а а а а а а а а /product="small secreted gut protein" аа а а а а а а а а а /protein_id="ABE26929" аа а а а а а а а а а /translation="MKLSLFIVIGALFCATVKSSERSSLIHEIMKKNGSDFVQAFQCM аа а а а а а а а а а VDVVGTVSNANGFSELWSQSEPVAKYHLEKWLMCPQAGDKLAVVLCNIREGLLTIQVL аа а а а а а а а а а NEYFQLVFAQNPKVSKLIAVEYYKRCASFELVDDFLPEYLNEKEIIVNDMI" ORIGIN а а а аа а а а1 cattcgtttt gtatttcagt aacgacatca aaatgaaatt atcattgttc attgttattg аа а а 61 gtgcactttt ttgtgccacg gtgaaatcaa gtgaacgatc atcattaatt catgaaataa аа а а121 tgaaaaaaaa tggttcagat tttgttcagg cattccaatg tatggtcgat gtcgttggta аа а а181 cggtctcaaa tgcgaatggt ttttctgaac tatggtctca atcagagccc gttgccaaat аа а а241 atcatttgga aaaatggcta atgtgtcctc aggcaggcga taaattggct gttgttttgt аа а а301 gtaacattcg agagggactg ctaactatac aagttctaaa cgaatatttt caattggttt аа а а361 ttgctcaaaa tccaaaagtg tccaaactca tcgctgttga atattataaa cgttgcgcat аа а а421 catttgaatt agttgatgac tttttgccag aatacttgaa cgaaaaagag atcatcgtca аа а а481 atgatatgat ctaatgtaaa taactattcc gacgattcca ttttaacaga aaaaaataaa аа а а541 acgaacacag aaattattgc tgctttagaa ttggcaaaat tattattatt cacaaattaa аа а а601 tatgaatata tttttgtttt gatcgctgaa attaaatttg gattgggaatwxю я ╠═ъ╪ъ╪ъ╟ hlkьh№hCJOJQJ^JaJ#hlkьB*CJOJQJ^JaJph)hlkьhlkьB*CJOJQJ^JaJph═·gdlkь═■ 1Рh░╨/ ░р=!░"░#Ра$Ра%░ЬD@ё D NormalCJ_HaJmH nHsH tHDA@Є бD Default Paragraph FontRi@є │R  Table NormalЎ4╓ l4╓aЎ (k@Ї ┴(No List═     ╧ Ш0АА═ ═ ═ )+\e│╢№+4LUW^`jltv}ИЦЮанп╢╕┬─╬▄щыЇ"(.36;AJPY╤┌AGirХЭ╗┬(3ЗСЮий│┤╛┐╔╩╘╒▀ъЇї    !+6@AKLVWablmwВМНЧШвгно╕╣├╬╪┘уфюя∙·$%/0:;EFPQ[fpq{|ЖЗСТЬЭз▓╝╜╟╚╥╙▌▐шщє■     ) * 4 5 ? J T U _ ` j k u v А Б Л Ц а б л м ╢ ╖ ┴ ┬ ╠ ╧ Pe╕я╧ 33╧ ╧   m. ChenхГ(мE?20B Q╒&^MI^№ht#гM╢Уv╕▄=╣ll╛дy└F0╞ 7╠zчlkь3?ї @w|Ё┘Юww═ P@  Unknown            GРЗz А Times New Roman5РАSymbol3&Р Зz А Arial?5Р Зz А Courier New;РЖSimSunЛ[SO"qИЁ╨h╣sдж╣sджvWvW▒Ёа┤┤ББ24╚ ╚ 3ГQЁH)Ё ?ф                     №h  OLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006m. Chenm. Chen■ рЕЯЄ∙OhлС+'│┘0░РШЁ№ $4 DP l xДРШаифPLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006OCUm. Chen. C. CNormalm. Chen2 CMicrosoft Word 10.0@@╬ГЧ¤_╞@╬ГЧ¤_╞vW■ ╒═╒Ь.УЧ+,∙о0< hpАИРШ аи░╕└ фUSDA ╚ A PLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006 Title ■   ■   ■    !"#$■   &'()*+,■   ¤   /■   ■   ■                                                                                                                                                                                                                                                                                                                           Root Entry         └FЁ┴h║¤_╞1АData             1Table    WordDocument    "SummaryInformation(            DocumentSummaryInformation8        %CompObj            j            ■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ■       └FMicrosoft Word Document MSWordDocWord.Document.8Ї9▓q