ࡱ> .0-5@ fbjbj22 "XXf 6666666Jnnnn z J2>@@@@@@$RC d6d66y*66>> 66  ė_n" >0 '  ' JJ6666' 6 4ddJJ$n JJnLOCUS DQ458301 565 bp mRNA linear INV 05-APR-2006 DEFINITION Mayetiola destructor clone Lg3H4 small secreted gut protein mRNA, complete cds. ACCESSION DQ458301 VERSION DQ458301 KEYWORDS . SOURCE Mayetiola destructor (Hessian fly) ORGANISM Mayetiola destructor Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea; Cecidomyiidae; Mayetiola. REFERENCE 1 (bases 1 to 565) AUTHORS Chen,M.-S., Liu,X., Zhu,Y.-C., Reese,J.C. and Wilde,G.E. TITLE Genes Encoding a Group of Related Small Secreted Proteins from the Gut of Hessian Fly Larvae [Mayetiola destructor (Say)] JOURNAL Insect Sci. (2006) In press REFERENCE 2 (bases 1 to 565) AUTHORS Chen,M.-S. TITLE Direct Submission JOURNAL Submitted (17-MAR-2006) USDA-ARS and Department of Entomology, Kansas State University, 123 Waters Hall, Manhattan, KS 66506, USA FEATURES Location/Qualifiers source 1..565 /organism="Mayetiola destructor" /mol_type="mRNA" /db_xref="taxon:39758" /clone="Lg3H4" CDS 36..497 /codon_start=1 /product="small secreted gut protein" /protein_id="ABE26919" /translation="MKLSLFIVIGALFCATVKSSERSSLIRELMKKNGSDFVQAFQCM VDVVGTVSNANGFSELWSQSEPVAKYHLEKWLMCPQAGDKLAVVLCNIREGLLTIQVL NEYFQLVFAQNPKVSKLIAVEYYKRCASFELVDDFLPEYLNEKEIIVNDMI" ORIGIN 1 ttacattcgt tttgtatttc agtaacgaca tcaaaatgaa attatcattg ttcattgtta 61 ttggtgcact tttttgtgcc acggtgaaat caagtgaacg atcatcatta attcgggaat 121 taatgaaaaa aaatggttca gattttgttc aggcattcca atgtatggtc gatgtcgttg 181 gtacggtctc aaatgcgaat ggtttttctg aactatggtc tcaatcagag cccgttgcca 241 aatatcattt ggaaaaatgg ctaatgtgtc ctcaggcagg cgataaattg gctgttgttt 301 tgtgtaacat tcgagaggga ctgctaacta tacaagttct aaacgaatat tttcaattgg 361 tttttgctca aaatccaaaa gtgtccaaac tcatcgctgt tgaatattat aaacgttgcg 421 catcatttga attagttgat gactttttgc cagaatactt gaacgaaaaa gagatcatcg 481 tcaatgatat gatctaatgt aaataactat tccgacgatt ccattttaac agaaaaaata 541 aaacgaacac agaaattatt gctgcef hyhhCJOJQJ^JaJ)hyhyB*CJOJQJ^JaJphfgdyf 1h/ =!"#$%D@D NormalCJ_HaJmH nHsH tHDA@D Default Paragraph FontRi@R  Table Normal4 l4a (k@(No Listf  h 0f f f )+\e+4LUW^`jltv}"(.36;AJPYAGir(3   !+6@AKLVWablmw$%/0:;EFPQ[fpq{|     ) * 4 5 ? J T U _ ` e h Peh 33h h m. Chen(ht#=llyF0@ٞf @UnknownGz Times New Roman5Symbol3& z Arial?5 z Courier New;SimSun[SO"qhZsZsgg24b b 3H)?hOLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006m. Chenm. ChenOh+'0 $4 DP l xPLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006OCUm. Chen. C. CNormalm. Chen2 CMicrosoft Word 10.0@F#@_@_g՜.+,0< hp  USDA b A PLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006 Title  !"#$&'()*+,/Root Entry F`f_1Data 1TableWordDocument"SummaryInformation(DocumentSummaryInformation8%CompObjj  FMicrosoft Word Document MSWordDocWord.Document.89q