╨╧рб▒с>■  .0■   -                                                                                                                                                                                                                                                                                                                                                                                                                                                ье┴5@ Ё┐яbjbj╧2╧2 "нXнXя       И6666666Jnnnn z J;2ТТТТТТТТ║╝╝╝╝╝╝$mR┐ фр6ТТТТТр66ТТїjjjТв6Т6Т║jТ║jjВ66ВТЖ р█ё_╞n4"В║ 0;Вг V г ВJJ6666г 6В8ТТjТТТТТррJJ$n` JJnLOCUS а а а DQ458302 а а а а а а а а 671 bp а аmRNA а аlinear а INV 05-APR-2006 DEFINITION аMayetiola destructor clone Lg4D4 small secreted gut protein mRNA, аа а а а а аcomplete cds. ACCESSION а DQ458302 VERSION а а DQ458302 KEYWORDS а а. SOURCE а а аMayetiola destructor (Hessian fly) ааORGANISM аMayetiola destructor аа а а а а аEukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; аа а а а а аNeoptera; Endopterygota; Diptera; Nematocera; Sciaroidea; аа а а а а аCecidomyiidae; Mayetiola. REFERENCE а 1 а(bases 1 to 671) ааAUTHORS а Chen,M.-S., Liu,X., Zhu,Y.-C., Reese,J.C. and Wilde,G.E. ааTITLE а а Genes Encoding a Group of Related Small Secreted Proteins from the аа а а а а аGut of Hessian Fly Larvae [Mayetiola destructor (Say)] ааJOURNAL а Insect Sci. (2006) In press REFERENCE а 2 а(bases 1 to 671) ааAUTHORS а Chen,M.-S. ааTITLE а а Direct Submission ааJOURNAL а Submitted (17-MAR-2006) USDA-ARS and Department of Entomology, аа а а а а аKansas State University, 123 Waters Hall, Manhattan, KS 66506, USA FEATURES а а а а а а Location/Qualifiers аа а source а а а а а1..671 аа а а а а а а а а а /organism="Mayetiola destructor" аа а а а а а а а а а /mol_type="mRNA" аа а а а а а а а а а /db_xref="taxon:39758" аа а а а а а а а а а /clone="Lg4D4" аа а CDS а а а а а а 36..497 аа а а а а а а а а а /codon_start=1 аа а а а а а а а а а /product="small secreted gut protein" аа а а а а а а а а а /protein_id="ABE26920" аа а а а а а а а а а /translation="MKLSLFIVIGALFCATVKSSERSSLIRELMKKNGSDFVQAFQCM аа а а а а а а а а а VDVVGTVSNANGFSELWSQSEPVAKYHLEKWLMCPQAGDKLAVVLCNIREGLLTIQVL аа а а а а а а а а а NEYFQLVFAQNPKVSKLIAVEYYKRCASFELVDDFLPEFLNEKEIIINDMI" ORIGIN а а а аа а а а1 ttacattcgt tttgtatttc agtaacgaca tcaaaatgaa attatcattg ttcattgtta аа а а 61 ttggtgcact tttttgtgcc acggtgaaat caagtgaacg atcatcatta attcgggaat аа а а121 taatgaaaaa aaatggttca gattttgttc aggcattcca atgtatggtc gatgtcgttg аа а а181 gtacggtctc aaatgcgaat ggtttttctg aactatggtc tcaatcagag cccgttgcca аа а а241 aatatcattt ggaaaaatgg ctaatgtgtc ctcaggcagg cgataaattg gctgttgttt аа а а301 tgtgtaacat tcgagaggga ctgctaacta tacaagttct aaacgaatat tttcaattgg аа а а361 tttttgctca aaatccaaaa gtgtccaaac tcatcgctgt tgaatattat aaacgttgcg аа а а421 catcatttga attagttgat gactttttgc cagaattctt gaacgaaaaa gagatcatca аа а а481 tcaatgatat gatctaatga taataactat tccgacgttt ccattttaac agaaaaaata аа а а541 aaacgaacac agaaattatt gctgctttag aattggcaaa attattatta ttcacaaatt аа а а601 aatatgaata tttttgtttt gatcgctgaa attaaatttg gattgggaaa taaagaaatt аа а а661 gaagcagcgt tюяъ┘ hмE?h№hCJOJQJ^JaJ)hмE?hмE?B*CJOJQJ^JaJphя·gdмE?я■ 1Рh░╨/ ░р=!░"░#Ра$Ра%░ЬD@ё D NormalCJ_HaJmH nHsH tHDA@Є бD Default Paragraph FontRi@є │R  Table NormalЎ4╓ l4╓aЎ (k@Ї ┴(No Listя      ё Ш0ААя я я )+\e│╢№+4LUW^`jltv}ИЦЮанп╢╕┬─╬▄щыЇ"(.36;AJPY╤┌AGirХЭ╗┬(3ЗСЮий│┤╛┐╔╩╘╒▀ъЇї    !+6@AKLVWablmwВМНЧШвгно╕╣├╬╪┘уфюя∙·$%/0:;EFPQ[fpq{|ЖЗСТЬЭз▓╝╜╟╚╥╙▌▐шщє■     ) * 4 5 ? J T U _ ` j k u v А Б Л Ц а б л м ╢ ╖ ┴ ┬ ╠ ═ ╫ т ь ё Pe╕яё 33ё ё   m. ChenхГ(мE?№ht#г▄=╣ll╛дy└F0╞ @юєЁ┘Юююя ░@  Unknown            GРЗz А Times New Roman5РАSymbol3&Р Зz А Arial?5Р Зz А Courier New;РЖSimSunЛ[SO"qИЁ╨h[sдж[sдж{t{t▒Ёа┤┤ББ24ъ ъ 3ГЁH)Ё ?ф                     №h  OLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006m. Chenm. Chen■ рЕЯЄ∙OhлС+'│┘0░РШЁ№ $4 DP l xДРШаифPLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006OCUm. Chen. C. CNormalm. Chen2 CMicrosoft Word 10.0@F├#@2▌ё_╞@2▌ё_╞{t■ ╒═╒Ь.УЧ+,∙о0< hpАИРШ аи░╕└ фUSDA ъ A PLOCUS DQ458295 542 bp mRNA linear INV 05-APR-2006 Title ■   ■   ■    !"#$■   &'()*+,■   ¤   /■   ■   ■                                                                                                                                                                                                                                                                                                                           Root Entry         └F└чё_╞1АData             1Table    WordDocument    "SummaryInformation(            DocumentSummaryInformation8        %CompObj            j            ■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ■       └FMicrosoft Word Document MSWordDocWord.Document.8Ї9▓q